Loading...
Statistics
Advertisement

While I'm Waiting
www.whileiwait.org/

Whileiwait.org

Advertisement
Conversion Technology Metas Server
Whileiwait.org is hosted in United States / San Francisco . Whileiwait.org uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 5. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Whileiwait.org

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes
  • SVG

Advertisement

Javascripts

Number of occurences: 5
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Whileiwait.org

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 315220606725537856826659676906445890616412
    • validFrom: 160815185200Z
    • validTo: 161113185200Z
    • validFrom_time_t: 1471287120
    • validTo_time_t: 1479063120
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: F9:7E:F4:92:98:3E:94:E6:31:A1:FE:45:62:B2:3A:65:28:45:B5:65
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:tls.automattic.com, DNS:whileifelse.com, DNS:whileimghana.com, DNS:whileimwaiting.org, DNS:whileimwaitingblog.com, DNS:whileinaustralia.com, DNS:whileinheels.com, DNS:whileinswitzerland.com, DNS:whileiwait.org, DNS:whileiwasreading.com, DNS:whilejacknaps.com, DNS:whilemaandpawsawaypetservices.com, DNS:whilemollynaps.com, DNS:whilemywifeisatwork.com, DNS:whileoutsailing.com, DNS:whilepaper.com, DNS:whilerain.com, DNS:whileriversleeps.com, DNS:whilesilent.com, DNS:whilethecatnaps.com, DNS:whiletoday.com, DNS:whileurwaiting.com, DNS:whilewaitingtoexhale.com, DNS:whilewalkingmydogs.com, DNS:whileweslept.net, DNS:whileweslept.org, DNS:whilewetarry.org, DNS:www.whileimghana.com, DNS:www.whileimwaiting.org, DNS:www.whileimwaitingblog.com, DNS:www.whileinaustralia.com, DNS:www.whileinheels.com, DNS:www.whileinswitzerland.com, DNS:www.whileiwait.org, DNS:www.whileiwasreading.com, DNS:www.whilejacknaps.com, DNS:www.whilemaandpawsawaypetservices.com, DNS:www.whilemollynaps.com, DNS:www.whilemywifeisatwork.com, DNS:www.whileoutsailing.com, DNS:www.whilepaper.com, DNS:www.whilerain.com, DNS:www.whileriversleeps.com, DNS:www.whilesilent.com, DNS:www.whilethecatnaps.com, DNS:www.whiletoday.com, DNS:www.whileurwaiting.com, DNS:www.whilewaitingtoexhale.com, DNS:www.whilewalkingmydogs.com, DNS:www.whileweslept.net, DNS:www.whileweslept.org
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Whileiwait.org

Number of occurences: 8
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: application-name
    Content: While I'm Waiting
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: While I'm Waiting on WordPress.com

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns1.wordpress.com
  • ns2.wordpress.com
  • ns3.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 10 Sep 2016 19:36:51 GMT Content-Type: text/html Content-Length: 178 Location: https://www.whileiwait.org/ X-ac: 3.bur _bur X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 10 Sep 2016 19:36:52 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Strict-Transport-Security: max-age=86400 Location: https://whileiwait.org/ X-ac: 3.bur _bur HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sat, 10 Sep 2016 19:36:53 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.bur _bur

DNS

host: whileiwait.org
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: whileiwait.org
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: whileiwait.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: whileiwait.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: whileiwait.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: whileiwait.org
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hileiwait.org, www.w hileiwait.org, www. hileiwait.org, www.wchileiwait.org, www.chileiwait.org, www.whileiwait.org, www.hileiwait.org, www.wdhileiwait.org, www.dhileiwait.org, www.wfhileiwait.org, www.fhileiwait.org, www.wghileiwait.org, www.ghileiwait.org, www.wbhileiwait.org, www.bhileiwait.org, www.wileiwait.org, www.wheileiwait.org, www.weileiwait.org, www.whdileiwait.org, www.wdileiwait.org, www.whcileiwait.org, www.wcileiwait.org, www.whuileiwait.org, www.wuileiwait.org, www.whjileiwait.org, www.wjileiwait.org, www.whileiwait.org, www.wileiwait.org, www.whbileiwait.org, www.wbileiwait.org, www.whgileiwait.org, www.wgileiwait.org, www.whleiwait.org, www.whirleiwait.org, www.whrleiwait.org, www.whifleiwait.org, www.whfleiwait.org, www.whivleiwait.org, www.whvleiwait.org, www.whikleiwait.org, www.whkleiwait.org, www.whi,leiwait.org, www.wh,leiwait.org, www.whibleiwait.org, www.whbleiwait.org, www.whigleiwait.org, www.whgleiwait.org, www.whitleiwait.org, www.whtleiwait.org, www.whiyleiwait.org, www.whyleiwait.org, www.whiuleiwait.org, www.whuleiwait.org, www.whijleiwait.org, www.whjleiwait.org, www.whimleiwait.org, www.whmleiwait.org, www.whinleiwait.org, www.whnleiwait.org, www.whieiwait.org, www.whilueiwait.org, www.whiueiwait.org, www.whil8eiwait.org, www.whi8eiwait.org, www.whil9eiwait.org, www.whi9eiwait.org, www.whiljeiwait.org, www.whijeiwait.org, www.whil0eiwait.org, www.whi0eiwait.org, www.whilmeiwait.org, www.whimeiwait.org, www.whilpeiwait.org, www.whipeiwait.org, www.whiloeiwait.org, www.whioeiwait.org, www.whiliwait.org, www.whilexiwait.org, www.whilxiwait.org, www.whilesiwait.org, www.whilsiwait.org, www.whilewiwait.org, www.whilwiwait.org, www.whileriwait.org, www.whilriwait.org, www.whilefiwait.org, www.whilfiwait.org, www.whileviwait.org, www.whilviwait.org, www.whileciwait.org, www.whilciwait.org, www.whileqiwait.org, www.whilqiwait.org, www.whileaiwait.org, www.whilaiwait.org, www.whileyiwait.org, www.whilyiwait.org, www.whilewait.org, www.whileirwait.org, www.whilerwait.org, www.whileifwait.org, www.whilefwait.org, www.whileivwait.org, www.whilevwait.org, www.whileikwait.org, www.whilekwait.org, www.whilei,wait.org, www.while,wait.org, www.whileibwait.org, www.whilebwait.org, www.whileigwait.org, www.whilegwait.org, www.whileitwait.org, www.whiletwait.org, www.whileiywait.org, www.whileywait.org, www.whileiuwait.org, www.whileuwait.org, www.whileijwait.org, www.whilejwait.org, www.whileimwait.org, www.whilemwait.org, www.whileinwait.org, www.whilenwait.org, www.whileiait.org, www.whileiw ait.org, www.whilei ait.org, www.whileiwcait.org, www.whileicait.org, www.whileiwait.org, www.whileiait.org, www.whileiwdait.org, www.whileidait.org, www.whileiwfait.org, www.whileifait.org, www.whileiwgait.org, www.whileigait.org, www.whileiwbait.org, www.whileibait.org, www.whileiwit.org, www.whileiwaoit.org, www.whileiwoit.org, www.whileiwapit.org, www.whileiwpit.org, www.whileiwa9it.org, www.whileiw9it.org, www.whileiwait.org, www.whileiwit.org, www.whileiwaiit.org, www.whileiwiit.org, www.whileiwauit.org, www.whileiwuit.org, www.whileiwat.org, www.whileiwairt.org, www.whileiwart.org, www.whileiwaift.org, www.whileiwaft.org, www.whileiwaivt.org, www.whileiwavt.org, www.whileiwaikt.org, www.whileiwakt.org, www.whileiwai,t.org, www.whileiwa,t.org, www.whileiwaibt.org, www.whileiwabt.org, www.whileiwaigt.org, www.whileiwagt.org, www.whileiwaitt.org, www.whileiwatt.org, www.whileiwaiyt.org, www.whileiwayt.org, www.whileiwaiut.org, www.whileiwaut.org, www.whileiwaijt.org, www.whileiwajt.org, www.whileiwaimt.org, www.whileiwamt.org, www.whileiwaint.org, www.whileiwant.org,

Other websites we recently analyzed

  1. 中国通机门户
    Central District (Hong Kong) - 203.124.13.147
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Php
    Number of meta tags: 1
  2. Danetec Systems
    Danetec Systems -- Brake Time System
    Scottsdale (United States) - 72.167.131.153
    Server software: Apache
    Technology: CSS
    Number of meta tags: 3
  3. Die 4Münch's
    Germany - 217.160.223.86
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  4. Sint Theunis
    Denmark - 46.30.213.112
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 2
  5. Michigan Family Law Attorney Paul J. Tafelski - Call (248) 221-1060 NOW !
    Attorney Paul J. Tafelski is committed to provide strong and efficient Family Law representation across all major counties of Michigan. Call (248) 221-1060 now
    San Antonio (United States) - 104.239.144.219
    G Analytics ID: UA-46099831-2
    Server software: nginx
    Technology: CSS, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, jQuery, jQuery Cookie, Php, Pingback, Revslider, Google Analytics, Wordpress
    Number of Javascript: 25
    Number of meta tags: 3
  6. River Club Archery
    Pompano Beach (United States) - 162.210.102.213
    Server software: Apache
    Technology: CSS, Cufon, Html, Javascript, jQuery Cycle
    Number of Javascript: 5
    Number of meta tags: 5
  7. hüte.at - Diese Website steht zum Verkauf! - Informationen zum Thema Hüte.
    Diese Website steht zum Verkauf! hüte.at ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf hüte.at alles. Wir hoffen, dass Sie hier das Gesuchte finden!
    Cambridge (United States) - 72.52.4.120
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 4
    Number of meta tags: 5
  8. docareers.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  9. taobao.cat
    Germany - 217.160.230.136
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  10. CJ Creative Design, LLC | Helping small buisnesses create or update their professional identities
    United States - 192.195.77.67
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, SuperFish, Wordpress
    Number of Javascript: 12
    Number of meta tags: 3

Check Other Websites